Protein Info for Synpcc7942_2096 in Synechococcus elongatus PCC 7942

Annotation: diguanylate cyclase with GAF sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 425 to 444 (20 residues), see Phobius details PF00571: CBS" amino acids 13 to 62 (50 residues), 32.6 bits, see alignment 2.1e-11 amino acids 75 to 130 (56 residues), 22.7 bits, see alignment 2.6e-08 amino acids 141 to 198 (58 residues), 27.9 bits, see alignment 5.9e-10 amino acids 211 to 263 (53 residues), 36 bits, see alignment 1.8e-12 PF13185: GAF_2" amino acids 330 to 472 (143 residues), 30.1 bits, see alignment E=1.3e-10 PF01590: GAF" amino acids 331 to 471 (141 residues), 70.6 bits, see alignment E=4.9e-23 PF13492: GAF_3" amino acids 331 to 473 (143 residues), 30.2 bits, see alignment E=1.3e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 489 to 655 (167 residues), 180.2 bits, see alignment E=1.3e-57 PF00990: GGDEF" amino acids 491 to 652 (162 residues), 189.2 bits, see alignment E=1.1e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_2096)

Predicted SEED Role

"Phytochrome-like protein; Cph2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LE3 at UniProt or InterPro

Protein Sequence (664 amino acids)

>Synpcc7942_2096 diguanylate cyclase with GAF sensor (Synechococcus elongatus PCC 7942)
MTKIPMFELEEAIDRQPLTVAPTLPVAQVLAVMERQHSSYVLLMESNQTLVGIFTERDLV
RLTAIGITITSTPIEEVATSTVTTIQESDIYDVIRTLNLFRQYNVRHLPVVNATHQLIGI
MTYEGIRRLLKPIDLLRLRRVSEVMVKSIICADRYQSALSLAKLMSDRLISCVVITEKDP
SGFPKPIGLVTERDILHLQVQGADLSQTIAADFMGSPPVFIQASDTLWQANQYMRARKIR
RLLVVDERNIMVGLLTQTSLIHMIDPVEATLTIETLQQMVGERTVALDAANEKLERKALE
RKRAKAALQQQIYRERLVNRTAQRIRESLQLDEILVTTVSEVRQFLKAERVLIYRFQPNQ
QGAIAAESTDSNQTLIQGNAELEAILQEIDPTFYSCDRIHSIPDLQAQGLELTNATLLKR
LQLRASLVAPIFAQEILWGLLIVGQNSQPRRWEKLEIDLLKQLATQVGIAIQQARLYAQL
AAANQQLLRLAQSDGLTGLANRRHFDQCLDIEWQRAIREQHPLGLILIDIDCFKQFNDTY
GHQAGDDCLKAVATALTQVIARPADLVARYGGEEFVVILPNTNEQGILQIAESMRSAVQQ
LKIPHRSSSVCSSVSLSLGAVTWVPTPHKSPEALIAAADQALYQAKELGRNRVCLAGVRL
LETT