Protein Info for Synpcc7942_2090 in Synechococcus elongatus PCC 7942

Name: thrA
Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF03447: NAD_binding_3" amino acids 22 to 139 (118 residues), 83.3 bits, see alignment E=3.3e-27 PF00742: Homoserine_dh" amino acids 147 to 329 (183 residues), 221.5 bits, see alignment E=1e-69 PF01842: ACT" amino acids 369 to 433 (65 residues), 45.1 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 61% identical to DHOM_SYNY3: Homoserine dehydrogenase (hom) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 100% identity to syf:Synpcc7942_2090)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LE9 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Synpcc7942_2090 homoserine dehydrogenase (Synechococcus elongatus PCC 7942)
MVQAVSVDDWKQRVTFKVGLLGLGTVGTGTAQILLDPADRQPLLQELELYRVGVRSLDKP
RSVDISRDRLTTDLESIVRDPAVDIVVELLGGLEPSRSLILTAIAHGKHVVTANKAVIAR
YGEEIFAAAADAGVYVLLEAAVGGGIPVIEPLKQSLCANRIQGILGIINGTTNYILTRMQ
REGGDFGPILADAQRLGYAEADPTADVDGWDAADKIAILASLAFGGRVERSQITCEGIRA
ITASDIAYAEGLGFTIKLLAKAKRQHQGDTWRLEASVYPTLVPLSHPLASVNDVYNAILV
EGDPVGQVMFFGPGAGAGPTASAVVADILNIAAVLSAGSDRDHLDPLLACRYLQTVELAP
AAETAARFYLRIVVQDSPGVIGKVGTIFGEQGISLESIVQTDVSGETAELVVITHEVQEG
IMRQAITQLEALPLVQAIANLLHVL