Protein Info for Synpcc7942_2087 in Synechococcus elongatus PCC 7942

Name: hisF
Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 254 (254 residues), 386.2 bits, E=3e-120
• PF00977: His_biosynth
  • amino acids 5 to 238 (234 residues), 289.5 bits, E=3.5e-90

Best Hits

Swiss-Prot: 99% identical to HIS6_SYNP6: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to syf:Synpcc7942_2087)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

See Q31LF2 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Synpcc7942_2087 imidazole glycerol phosphate synthase subunit HisF (Synechococcus elongatus PCC 7942)
MLAKRILPCLDVKAGRVVKGVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQ
ILVDVVYRTAEQVFIPLTVGGGINDLETIRQLLRAGADKVSINSAAVRDPDLIRRASDRF
GSQCIVVAIDARRRTDPDNPGWDVYVRGGRENTGIDALTWAETVARNGAGELLVTSMDAD
GTQAGYDLELTRAIADRVEIPVIASGGAGTCEDIAEAFRTGHAEAALLASLLHYGQLTIA
EIKDHLRSAQIPTRP