Protein Info for Synpcc7942_2062 in Synechococcus elongatus PCC 7942

Name: crtL
Annotation: lycopene cyclase (CrtL-type)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05834: Lycopene_cycl
  • amino acids 3 to 390 (388 residues), 286.8 bits, E=7.4e-89
• PF00890: FAD_binding_2
  • amino acids 3 to 27 (25 residues), 20.8 bits, see alignment (E = 5.2e-08)
• TIGR01790: lycopene cyclase family protein
  • amino acids 3 to 393 (391 residues), 541.6 bits, E=5.7e-167

Best Hits

Swiss-Prot: 100% identical to LCYB_SYNE7: Lycopene beta cyclase (crtL) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K06443, lycopene beta cyclase [EC: 1.14.-.-] (inferred from 100% identity to syc:syc2031_d)

Predicted SEED Role

"Lycopene beta cyclase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Ascorbate and aldarate metabolism
• Benzoxazinone biosynthesis
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of steroids
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Sphingolipid metabolism
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

See Q55276 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Synpcc7942_2062 lycopene cyclase (CrtL-type) (Synechococcus elongatus PCC 7942)
VFDALVIGSGPAGLAIAAELAQRGLKVQGLSPVDPFHPWENTYGIWGPELDSLGLEHLFG
HRWSNCVSYFGEAPVQHQYNYGLFDRAQLQQHWLRQCEQGGLQWQLGKAAAIAHDSHHSC
VTTAAGQELQARLVVDTTGHQAAFIQRPHSDAIAYQAAYGIIGQFSQPPIEPHQFVLMDY
RSDHLSPEERQLPPTFLYAMDLGNDVYFVEETSLAACPAIPYDRLKQRLYQRLATRGVTV
QVIQHEEYCLFPMNLPLPDLTQSVVGFGGAASMVHPASGYMVGALLRRAPDLANAIAAGL
NASSSLTTAELATQAWRGLWPTEKIRKHYIYQFGLEKLMRFSEAQLNHHFQTFFGLPKEQ
WYGFLTNTLSLPELIQAMLRLFAQAPNDVRWGLMEQQGRELQLFWQAIAAR