Protein Info for Synpcc7942_2046 in Synechococcus elongatus PCC 7942

Name: gcsH
Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GCSH_SYNE7: Glycine cleavage system H protein (gcvH) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to syf:Synpcc7942_2046)

MetaCyc: 54% identical to glycine cleavage system H-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

photorespiration I (8/9 steps found)
photorespiration III (8/9 steps found)
glycine biosynthesis II (3/3 steps found)
glycine cleavage (3/3 steps found)
photorespiration II (8/10 steps found)
folate transformations III (E. coli) (7/9 steps found)
glycine degradation (2/3 steps found)
reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
folate transformations II (plants) (7/11 steps found)
folate transformations I (8/13 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LJ3 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Synpcc7942_2046 glycine cleavage system protein H (Synechococcus elongatus PCC 7942)
MALIYPDNLRYFDSHEYVRLDGDIAVIGISAYAIDQLGDIVFLELPEVGSTIAIGASFGT
VESVKAVEEVYAPVTGEIIERNEAALEAPEILNSDPYEQGWLLKVQLTGKPDLSDSYDAA
QYQALVEGQ