Protein Info for Synpcc7942_2046 in Synechococcus elongatus PCC 7942
Name: gcsH
Annotation: glycine cleavage system protein H
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to GCSH_SYNE7: Glycine cleavage system H protein (gcvH) from Synechococcus elongatus (strain PCC 7942)
KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to syf:Synpcc7942_2046)MetaCyc: 54% identical to glycine cleavage system H-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]
Predicted SEED Role
"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)
MetaCyc Pathways
- photorespiration I (8/9 steps found)
- photorespiration III (8/9 steps found)
- glycine biosynthesis II (3/3 steps found)
- glycine cleavage (3/3 steps found)
- photorespiration II (8/10 steps found)
- folate transformations III (E. coli) (7/9 steps found)
- glycine degradation (2/3 steps found)
- reductive glycine pathway of autotrophic CO2 fixation (6/9 steps found)
- folate transformations II (plants) (7/11 steps found)
- folate transformations I (8/13 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.4.1.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31LJ3 at UniProt or InterPro
Protein Sequence (129 amino acids)
>Synpcc7942_2046 glycine cleavage system protein H (Synechococcus elongatus PCC 7942) MALIYPDNLRYFDSHEYVRLDGDIAVIGISAYAIDQLGDIVFLELPEVGSTIAIGASFGT VESVKAVEEVYAPVTGEIIERNEAALEAPEILNSDPYEQGWLLKVQLTGKPDLSDSYDAA QYQALVEGQ