Protein Info for Synpcc7942_1945 in Synechococcus elongatus PCC 7942

Name: uvrC
Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 TIGR00194: excinuclease ABC subunit C" amino acids 17 to 472 (456 residues), 519.8 bits, see alignment E=4.9e-160 PF01541: GIY-YIG" amino acids 27 to 101 (75 residues), 37 bits, see alignment E=1.2e-12 PF27096: UvrC_M" amino acids 112 to 206 (95 residues), 63.3 bits, see alignment E=8.9e-21 PF02151: UVR" amino acids 215 to 247 (33 residues), 42 bits, see alignment (E = 2e-14) PF22920: UvrC_RNaseH" amino acids 264 to 378 (115 residues), 110.2 bits, see alignment E=2e-35 PF08459: UvrC_RNaseH_dom" amino acids 395 to 571 (177 residues), 175 bits, see alignment E=3.8e-55 PF14520: HHH_5" amino acids 586 to 633 (48 residues), 33.3 bits, see alignment 2e-11 PF12826: HHH_2" amino acids 590 to 640 (51 residues), 35.3 bits, see alignment 3.5e-12

Best Hits

Swiss-Prot: 100% identical to UVRC_SYNE7: UvrABC system protein C (uvrC) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to syf:Synpcc7942_1945)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LU4 at UniProt or InterPro

Protein Sequence (643 amino acids)

>Synpcc7942_1945 excinuclease ABC subunit C (Synechococcus elongatus PCC 7942)
MIAATPMPLLKQPDRLEARLRELPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLE
RLNPRINLMVRQVCEIEIIVTDTEAEALALEANLIKQHQPHFNVLLKDDKKYPYLCITWS
DDYPRIFITRKRRLGNSRDRYYGPYVDTRLLRHTLFLVKRLFPLRQRPQPLFKDRTCLNY
DIGRCPGVCQSLIRPDDYRKTLQKVAMIFQGRSSELVELLEAQMLQAAENLEFEKAAKIR
DQIRGLEGLGAEQKVQLPDDRISRDAIALAMDEQHACIQLFQIRAGKLVGRLGFVADAQS
GSAAAIAQRVLEEHYASVDSVEIPQEVLVQHDLPEAELLEVWLSERRGRKVEILSPQRQI
KADLIAMVERNAEYELARTQQSAERHTASLIDLADLLDLPELPRRIEGYDISHIQGSDAV
ASQVVFIDGLPAKQHYRRYKIRNPEVRAGHSDDFASLAEVLHRRFRKFAEAKARGESLAP
SEQRQGSLLRPDDLADFPDLVMIDGGKGQLSAVVEVLRNLNLLEDVKLCSLAKKREEIFL
PGASDPLPTDAEQPGVQLLRRLRDEAHRFAVSFHRQKRTERMRRSRLDDIPGLGHKRQKE
LLAHFRSIDYLRLATPEQIAEVPGIGAVLAQQIWGYFHPSETA