Protein Info for Synpcc7942_1892 in Synechococcus elongatus PCC 7942
Annotation: Rhodanese-like
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y2203_SYNP6: UPF0176 protein syc2203_c (syc2203_c) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
KEGG orthology group: K07146, UPF0176 protein (inferred from 100% identity to syc:syc2203_c)Predicted SEED Role
"Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31LZ7 at UniProt or InterPro
Protein Sequence (269 amino acids)
>Synpcc7942_1892 Rhodanese-like (Synechococcus elongatus PCC 7942) MSLVLINFYRFVALGDCDRWRQWLQDLCTALGLRGTILLAPEGINAGLAGNTEAIAQFLS ELQQHPPFANLSFKSATVTDWPFARLKVKVKPEIVSLGCPELNPAERTGTLVAPQDWNQL LQDPEVVLIDVRNRFEIALGSFPRAIDPQTDRFRDFPRFVQEQLLPQPPAKVAMFCTGGI RCEKASAYLLEQGIETVYQLEGGILNYLEAIAPEENHWQGDCFVFDERIAVDRQLQTPQH QLCPACGQPVVATTCSHCQDSVQASSSPK