Protein Info for Synpcc7942_1858 in Synechococcus elongatus PCC 7942

Name: ho1
Annotation: Heme oxygenase (decyclizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF01126: Heme_oxygenase" amino acids 4 to 205 (202 residues), 308.8 bits, see alignment E=9.6e-97

Best Hits

Swiss-Prot: 72% identical to HO1_SYNY3: Heme oxygenase 1 (pbsA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00510, heme oxygenase [EC: 1.14.99.3] (inferred from 100% identity to syc:syc2236_c)

MetaCyc: 72% identical to heme oxygenase 1 (Synechocystis sp. PCC 6803)
RXN-17523 [EC: 1.14.15.20]

Predicted SEED Role

"Heme oxygenase (EC 1.14.99.3)" in subsystem Bilin Biosynthesis or Heme, hemin uptake and utilization systems in GramPositives or Oxygen and light sensor PpaA-PpsR (EC 1.14.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.20 or 1.14.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3G6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Synpcc7942_1858 Heme oxygenase (decyclizing) (Synechococcus elongatus PCC 7942)
MGANLATKLREGTKKAHTMAENVGFVKCFLKGVVEKNSYRKLVANLYFVYSAMEEELERH
RDNDKIAGIYFPVLNRKTSLERDLAFYYGEDWRQQIQPSKAAQSYVARIREVSNTAPELL
VGHAYTRYLGDLSGGQILKTIAQRGMNLDGAGTAFYEFEAIEDEKAFKQTYRQAMDTLPV
DEATADRIVEEANDAFGMNMAMFQELEGNLVAAIGKMFFNSLTRRFVRGSTELATAAE