Protein Info for Synpcc7942_1857 in Synechococcus elongatus PCC 7942

Name: mmsB
Annotation: 3-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 3 to 153 (151 residues), 103.8 bits, E=2e-33
• PF03807: F420_oxidored
  • amino acids 3 to 89 (87 residues), 21.8 bits, E=4.7e-08
• PF14833: NAD_binding_11
  • amino acids 162 to 282 (121 residues), 56.9 bits, E=4.8e-19
• PF21761: RedAm-like_C
  • amino acids 162 to 284 (123 residues), 30.5 bits, E=8.1e-11

Best Hits

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 100% identity to syf:Synpcc7942_1857)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

• glycolate and glyoxylate degradation I (2/4 steps found)
• D-glucarate degradation I (1/4 steps found)
• D-galactarate degradation I (1/4 steps found)
• superpathway of glycol metabolism and degradation (3/7 steps found)
• superpathway of D-glucarate and D-galactarate degradation (1/5 steps found)
• L-valine degradation I (2/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (5/31 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.31 or 1.1.1.60

Sequence Analysis Tools

See Q31M32 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Synpcc7942_1857 3-hydroxyacid dehydrogenase (Synechococcus elongatus PCC 7942)
MRCGLIGTGLLGTAIAERLLTVGQLLTVWNRTAERSQPLVALGATIAPTPAALLADCEVC
LLLLSDAEAIAATLLTEESRSQLVGKTIIQMGTISPAESRAIADQIAAAGGQYLEAPVLG
SLPEARNGTLIVMVGAEPAVFEQWRSLLCHLSPEPEWIGPIGTAATLKLALNQLIGSLTS
AFGGSLALLQRSGLAVEPFMAILRQSALYAPTFDKKLSRLLSHQYDNPNFPTTHLAKDLR
LFRETAADLGITTDAVEGVESIVQKAIAQGWGDQDYSALYEAINPDSN