Protein Info for Synpcc7942_1803 in Synechococcus elongatus PCC 7942

Annotation: putative ferric uptake regulator, FUR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF01475: FUR" amino acids 23 to 139 (117 residues), 76.7 bits, see alignment E=8.6e-26

Best Hits

Swiss-Prot: 31% identical to FUR_RHILV: Ferric uptake regulation protein (fur) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 100% identity to syf:Synpcc7942_1803)

Predicted SEED Role

"Peroxide stress regulator; Ferric uptake regulation protein; Fe2+/Zn2+ uptake regulation proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31M86 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Synpcc7942_1803 putative ferric uptake regulator, FUR family (Synechococcus elongatus PCC 7942)
MSETAAQTPIRSLEDALNRCQDKGMRVSRQRRYILELLWDVQEHLSAREIYDRLSRAGRD
IGHTSVYQNLEALAANGIVECLDRSEGRLYGNISDSHSHINCLDSNQIIDVQVQLPAELL
ERLEAETGVRIVDYRIDFYGYQR