Protein Info for Synpcc7942_1760 in Synechococcus elongatus PCC 7942

Name: ald
Annotation: L-alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00518: alanine dehydrogenase" amino acids 1 to 359 (359 residues), 559.2 bits, see alignment E=1.9e-172 PF05222: AlaDh_PNT_N" amino acids 4 to 136 (133 residues), 152.3 bits, see alignment E=9.6e-49 PF01262: AlaDh_PNT_C" amino acids 140 to 350 (211 residues), 289 bits, see alignment E=1.9e-90

Best Hits

Swiss-Prot: 53% identical to DHA_STAHJ: Alanine dehydrogenase (ald) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 100% identity to syc:syc2332_c)

MetaCyc: 73% identical to alanine dehydrogenase subunit (Phormidium lapideum)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MC9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Synpcc7942_1760 L-alanine dehydrogenase (Synechococcus elongatus PCC 7942)
MDIGVPRELKDQEFRVGLSPASVRALALQGHQIWIEQGAGVGSGFQDEDYLLAGAKVVAT
ATEAWQHPLVVKVKEPLPAEYDYLRPDLLLFTYLHLAADRPLTERLLASGTTAIAYETVT
ARNGSLPLLMPMSRIAGRLSVQFGARFLERQQGGRGVLLGGVPGVSPGTVMILGGGIVGT
EAAKMAIGLGAKVQIVDINVERLAELEALFGSRVELLYSSPAEIEARVPQADLLIGAVLV
PGRRAPILVNRDLIAQMRPGSVVVDVAVDQGGCVETLRPTSHSQPIYLEAGVVHYGVPNM
PGAVPWTATQALNNSTLPYVQAIAAQGLASCDRDPGLAEGLNVAQGVLTHPAIAAAFPDL
PCR