Protein Info for Synpcc7942_1745 in Synechococcus elongatus PCC 7942

Updated annotation (from data): nitrite transporter, HPP family
Rationale: Important for nitrite stress. This was shown to be capable of nitrite uptake (PMID:24904028), but with moderate affinity, and this data suggests that it might be exporting nitrite. Since nitrate was also present, this could also be a nitrate/nitrite antiporter (speculative).
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details PF04982: HPP" amino acids 59 to 172 (114 residues), 118.3 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_1745)

Predicted SEED Role

"Slr0789 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31ME4 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Synpcc7942_1745 nitrite transporter, HPP family (Synechococcus elongatus PCC 7942)
MAPRSLRRLHWHWEQQRSQSDLIQPRYSRQQVLASWLGALVGIGLLGWLTQASGYPLVAA
PMGATSVLLFGLPNSPLAQPRNVILGNGLGALIAVLCVLLLGANPWSMGFAVGVTIALTQ
LLRCVHPPAGAVALLGVIVKAKWAYILLPVLSGSILLCVITALYSRWAPDRHHRRYPVHW
L