Protein Info for Synpcc7942_1688 in Synechococcus elongatus PCC 7942

Name: cysW
Annotation: Sulfate ABC transporter, permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 65 to 92 (28 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 203 to 229 (27 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 17 to 275 (259 residues), 313 bits, see alignment E=1.9e-97 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 20 to 276 (257 residues), 347.3 bits, see alignment E=5.9e-108 PF00528: BPD_transp_1" amino acids 81 to 275 (195 residues), 57.5 bits, see alignment E=7.9e-20

Best Hits

Swiss-Prot: 51% identical to CYSW_SYNE7: Sulfate transport system permease protein CysW (cysW) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to syf:Synpcc7942_1688)

MetaCyc: 45% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MK1 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Synpcc7942_1688 Sulfate ABC transporter, permease protein CysW (Synechococcus elongatus PCC 7942)
MAPSVFVRSPAVSARPWQAYLLIGIGLAFLTAIVLLPLVVVFWEALREGLAAYWQGIQQP
EALHAIRLTLLITAVAIPLNTLFGVAIAWVLVRQSFPGQAIVLALLDLPLSISPVVAGFM
LILLYSPQIGWLADLVNRWDLKIVFATPGLVLTVMFVTIPFVAREVFPVLQTLSREDEEA
AQSLGATTWQTFWRVTLPMIRPALLYGIILSTARAIGEFGAVSVVSGKIIGSTNTLTLHV
ERVYLEYQATAAFACASLLAIVALLTLVLQYWIQQQPSSAAKNRQH