Protein Info for Synpcc7942_1671 in Synechococcus elongatus PCC 7942

Name: kdpC
Annotation: potassium-transporting ATPase, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details TIGR00681: K+-transporting ATPase, C subunit" amino acids 4 to 190 (187 residues), 217.3 bits, see alignment E=8.9e-69 PF02669: KdpC" amino acids 7 to 190 (184 residues), 213.1 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 56% identical to KDPC_SYNY3: Potassium-transporting ATPase KdpC subunit (kdpC) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 100% identity to syc:syc2419_c)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31ML8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Synpcc7942_1671 potassium-transporting ATPase, C subunit (Synechococcus elongatus PCC 7942)
MLLRNFRPALRITLVFWLLTAVIYPLVLFVIGQLVFPFQANGSLLTDAQGTVVGSQLIGQ
PFQSDRYFWGRPSAIAYATDPADRQTGISGNQHLGPTNPQLRDRIAAEARRLQAAGLSSI
PSDLLYSSASGLDPHISSAAAQAQVARVAAARQRSPEVIAELVECYRDRRVFGLIGGTGI
NVLQLNRALDLPQPSTNQICPKL