Protein Info for Synpcc7942_1667 in Synechococcus elongatus PCC 7942

Name: murD
Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF21799: MurD-like_N" amino acids 4 to 90 (87 residues), 27.3 bits, see alignment E=5.4e-10 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 5 to 458 (454 residues), 370 bits, see alignment E=9.6e-115 PF08245: Mur_ligase_M" amino acids 114 to 298 (185 residues), 86.2 bits, see alignment E=4.6e-28 PF02875: Mur_ligase_C" amino acids 320 to 437 (118 residues), 31.4 bits, see alignment E=4.9e-11

Best Hits

Swiss-Prot: 100% identical to MURD_SYNE7: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to syc:syc2422_c)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MM2 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Synpcc7942_1667 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (Synechococcus elongatus PCC 7942)
MQHAHVIGLGKSGCAAALLLRQQGWQVELSDRNAVAAPPELVSQGVQFRLGESLDPVAWG
WQTPEQRPNCIVVSPGVPWDLPGLRQAAEELQIETLGELELAWRTLSDIPWVAVTGTNGK
TTTTALIAAIFERAGLQAPACGNIGFAACEVARQQQQGEAKPLDWVIAEASSYQIEAAAT
LAATIGLWTTFTPDHLNRHYTLENYFTIKASLLDRAQQQVLNGDDPYLRNQANATSRWPL
AFWTSTQGAEALPTSRDRGFWIEEGWVIDRGDRLFPVERFSMVGNHNQQNLLMAVAAARL
AGIEAEAIAEAMANFPGIAHRLERVATWQGIELINDSKATNYDAAWVGLQAVPGPTILIA
GGEAKQGDDQAWLDLIQAKARAVLLIGSAAPLFARRLAEVGYSSPVENAETLDRAVPRAV
ELAQSLDASHVLLSPACASFDQYPNFEARGDHFRRCAQAIAKG