Protein Info for Synpcc7942_1582 in Synechococcus elongatus PCC 7942

Name: trmE
Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF10396: TrmE_N" amino acids 8 to 128 (121 residues), 134.3 bits, see alignment E=5e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 15 to 462 (448 residues), 487.1 bits, see alignment E=6.1e-150 PF12631: MnmE_helical" amino acids 131 to 459 (329 residues), 192.9 bits, see alignment E=1.6e-60 TIGR00231: small GTP-binding protein domain" amino acids 224 to 374 (151 residues), 89.2 bits, see alignment E=2.6e-29 PF01926: MMR_HSR1" amino acids 225 to 338 (114 residues), 95.1 bits, see alignment E=6e-31 PF02421: FeoB_N" amino acids 225 to 377 (153 residues), 38.8 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 100% identical to MNME_SYNE7: tRNA modification GTPase MnmE (mnmE) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to syf:Synpcc7942_1582)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8KPU2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Synpcc7942_1582 tRNA modification GTPase TrmE (Synechococcus elongatus PCC 7942)
MVGFSGDTIAAIATAIVPQQGSVGIVRLSGAAATEIARQIFQIAGQQPWESHRILYGYIR
DPESGRLVDEALLLPMLAPRSYTREDVVELHCHGGLMPVQQTLQLCIRAGARLAEPGEFT
LRAFLNGRLDLSQAESIADLISAQSPQAAQAALGSLQGKLGHPIRQLRDRCLDILAEVEA
RIDFEDDLPPLDLEAIAAQLTAAGADMQAILSTADRGELLRTGLKIAIVGRPNVGKSSLL
NAWSRCDRAIVTDLPGTTRDLVESQLIVGGIPVQVLDTAGIRETSDQVEQIGVERSRRAA
QSADLVLLTIDASAGWSAEDQTIWEAVSDRPILLVINKRDRLSEAERHAIALPQQEFKAI
VWTAAAQQQGIEDLEAAILAAVGTGDLTSANWDWALNQRQVAALTTAQTALRRVEETLQA
QLPLDFWTIDLREAIAALGSITGEEIAESMLDLIFSRFCIGK