Protein Info for Synpcc7942_1448 in Synechococcus elongatus PCC 7942

Name: nadA
Annotation: quinolinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 14 to 319 (306 residues), 399.7 bits, see alignment E=4.3e-124 PF02445: NadA" amino acids 19 to 317 (299 residues), 405.8 bits, see alignment E=5e-126

Best Hits

Swiss-Prot: 100% identical to NADA_SYNE7: Quinolinate synthase A (nadA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to syf:Synpcc7942_1448)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9L790 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Synpcc7942_1448 quinolinate synthetase (Synechococcus elongatus PCC 7942)
VFLAADRPTTDLPADLPAAIAALKQELNAVILAHYYQEAAIQDVADYIGDSLGLSRQAAA
ADADVIVFAGVHFMAETAKILNPQRQVLLPDLAAGCSLADSCPPEAFAAFKAAHPNHIVI
SYINCTAEIKALSDIICTSSNAVKIVQQIPVDQPIIFAPDRNLGRYVMQQTGRDLVLWDG
SCIVHETFSEQRLLELQARHPDAEIIAHPECETPVLDQARFIGSTTALLNYSLNSPSREF
IVVTEPGIIHQMQQAAPEKTFIPAPPQDTTCACNECPFMRLNTLEKLYLCMRDRRPEIQI
PEETRLAALRPIERMLAMSA