Protein Info for Synpcc7942_1398 in Synechococcus elongatus PCC 7942

Annotation: Cellulose synthase (UDP-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 426 to 453 (28 residues), see Phobius details amino acids 465 to 485 (21 residues), see Phobius details amino acids 541 to 560 (20 residues), see Phobius details amino acids 579 to 597 (19 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 177 to 401 (225 residues), 68 bits, see alignment E=3.2e-22 PF00535: Glycos_transf_2" amino acids 181 to 347 (167 residues), 85.1 bits, see alignment E=1.7e-27 PF13506: Glyco_transf_21" amino acids 241 to 405 (165 residues), 29.5 bits, see alignment E=1.1e-10 PF13632: Glyco_trans_2_3" amino acids 258 to 457 (200 residues), 68.8 bits, see alignment E=1.8e-22 PF03552: Cellulose_synt" amino acids 329 to 459 (131 residues), 44.2 bits, see alignment E=3.3e-15 PF07238: PilZ" amino acids 602 to 701 (100 residues), 50.6 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0157_d)

Predicted SEED Role

"UDP-glucose-beta-D-glucan glucosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NE1 at UniProt or InterPro

Protein Sequence (740 amino acids)

>Synpcc7942_1398 Cellulose synthase (UDP-forming) (Synechococcus elongatus PCC 7942)
MRFPNFLQRSPQSNLAPSQVSPGAWLFLAISIAVLVFALLSLNLSWLQNLPGYLNPQNVR
DLPESLSFPEDPRQLFQPLLLVAGLLLSLRILPHHPISHLLVLLTLLLYGIRYFTWRLFA
LNNGHIFSLTLSIIFLLTESLYVLSFLMQFYPTLVFDPKRRSRQADQQEALLSKFSPSVA
IWIPIYNEHPRIIRRTILACQLIDYENKEIYVLDDGHRSEIRAIATELGVHYLSRPDNTH
RKAGNLNYALNHTNSDLIAVFDCDFLPFNNFLKRTVGFFANEEIALVQTPQHYYNSDFHT
RNLGLDYVLPNDMDYFFHYIQPIRDQFNSVICCGTSYVARRSALEDVGGYYTDCIVEDFQ
TGTKLLLNHWRVVYLNEVLSIGEVPRHLSEYLQQRLRWMQGNIQLYCSHKQLPIWSGRLT
TWQRLFYLSILIYCLTPFMRAIYILLPLLSFLFGFTLIAAPPIEYFYYGLPFILLIYGAT
SWLTYNHYFLYWTEIYESIMCWPSLQRIIQVLFNPFGNFGSLVTAKGELDDRKRFNLKIS
WPFIAYLSLFGLGFCLRYVAPLLSPYFVRPSFEGEALMMIWNFYNAMLMSICLFACVDQP
IRRRFERYPYQAVACLEVNGHKFWGMTQDLSEGGASFILRNEQELQLIDEQAELVLLQED
LRIPVNVLRMSREAFNGHSQVGLEFQLSDTAAEKTLIRLLYVDSSLWWQQIRRSSAIDAF
LVLIRSALNPRALLTRYNNG