Protein Info for Synpcc7942_1379 in Synechococcus elongatus PCC 7942

Name: accC
Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00289: Biotin_carb_N" amino acids 3 to 111 (109 residues), 152.4 bits, see alignment E=1.5e-48 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 3 to 445 (443 residues), 800.5 bits, see alignment E=2.2e-245 PF02786: CPSase_L_D2" amino acids 116 to 323 (208 residues), 283.8 bits, see alignment E=1.9e-88 PF02222: ATP-grasp" amino acids 139 to 293 (155 residues), 43.1 bits, see alignment E=9.7e-15 PF07478: Dala_Dala_lig_C" amino acids 143 to 292 (150 residues), 35.3 bits, see alignment E=2.3e-12 PF02785: Biotin_carb_C" amino acids 337 to 444 (108 residues), 138.4 bits, see alignment E=2.3e-44

Best Hits

Swiss-Prot: 78% identical to ACCC_NOSS1: Biotin carboxylase (accC) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 100% identity to syf:Synpcc7942_1379)

MetaCyc: 68% identical to biotin carboxylase (Arabidopsis thaliana col)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14, 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q54755 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Synpcc7942_1379 acetyl-CoA carboxylase biotin carboxylase subunit (Synechococcus elongatus PCC 7942)
MRFNKILIANRGEIALRILRTCEELGIGTIAVHSTVDRNALHVQLADEAVCIGEAASSKS
YLNIPNIIAAALTRNASAIHPGYGFLAENARFAEICADHHLTFIGPSPDSIRAMGDKSTA
KETMQRVGVPTIPGSDGLLTDVDSAAKVAAEIGYPVMIKATAGGGGRGMRLVREPADLEK
LFLAAQGEAEAAFGNPGLYLEKFIDRPRHVEFQILADAYGNVVHLGERDCSIQRRHQKLL
EEAPSPALSADLRQKMGDAAVKVAQAIGYIGAGTVEFLVDATGNFYFMEMNTRIQVEHPV
TEMITGLDLIAEQIRIAQGEALRFRQADIQLRGHAIECRINAEDPEYNFRPNPGRITGYL
PPGGPGVRVDSHVYTDYEIPPYYDSLIGKLIVWGATREEAIARMQRALRECAITGLPTTL
SFHQLMLQMPEFLRGELYTNFVEQVMLPRILKS