Protein Info for Synpcc7942_1325 in Synechococcus elongatus PCC 7942

Name: dnaB
Annotation: primary replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00772: DnaB" amino acids 15 to 116 (102 residues), 116.1 bits, see alignment E=1.1e-37 TIGR00665: replicative DNA helicase" amino acids 16 to 447 (432 residues), 657 bits, see alignment E=6.3e-202 PF03796: DnaB_C" amino acids 190 to 445 (256 residues), 370.2 bits, see alignment E=7.8e-115 PF13481: AAA_25" amino acids 206 to 368 (163 residues), 37.6 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 50% identical to DNAB_TRICV: Probable replicative DNA helicase (dnaB) from Trieres chinensis

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to syc:syc0228_c)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NL4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Synpcc7942_1325 primary replicative DNA helicase (Synechococcus elongatus PCC 7942)
MVQELRFDILPDRHEPPQNVEAEEAILGSILLDPEAIGRIADVLSPEAFYNSNHRDIYRA
AVQLHSQGQPTDLTSLTTSLQDAGQLDKVGGQSRLAKLVDRVVTTANVEQYAQLVIDKFL
RRQLIQAGNSVIQLGYDTTKPLEAVLDQAEQKVFGITQERPTMGLLPAAEILTSTFAEIE
SRSMGTALSGISCNYYDLDAMTQGFQRSDLIIVAGRPAMGKTSIVLNIARNITVAHKLPV
CVFSLEMSKEQLIYRLLSMEIGIESSRLRSGRIGDHEWEMLGKGIMQLSQLPVFIDDTPG
LTVSEMRSKARRLMSEQGGQLGLILIDYLQLMEGSSSDNRVQEISKITRSLKGLARELNV
PVIALSQLSRGVESRTNKRPMMSDLRESGSIEQDADLVMMIYRDEYYNPDTPDRGITEII
VAKHRNGPVGTVKLLFEPQFTRFRNLAGSHAPTG