Protein Info for Synpcc7942_1315 in Synechococcus elongatus PCC 7942

Name: gid
Annotation: tRNA (uracil-5-)-methyltransferase Gid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00137: tRNA:m(5)U-54 methyltransferase" amino acids 6 to 448 (443 residues), 690.4 bits, see alignment E=4.6e-212 PF01134: GIDA" amino acids 8 to 381 (374 residues), 336.7 bits, see alignment E=3.2e-104 PF00890: FAD_binding_2" amino acids 8 to 55 (48 residues), 25.3 bits, see alignment 1.3e-09

Best Hits

Swiss-Prot: 100% identical to TRMFO_SYNE7: Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (trmFO) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K04094, glucose inhibited division protein Gid (inferred from 100% identity to syf:Synpcc7942_1315)

Predicted SEED Role

"tRNA:m(5)U-54 MTase gid" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NM4 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Synpcc7942_1315 tRNA (uracil-5-)-methyltransferase Gid (Synechococcus elongatus PCC 7942)
MAAISQPVIVIGAGLAGTEAAWQIAEAGVPVILYEMRPQRQSPAHHSESFAELVCSNSFG
AMASDRAAGLLHEELRRLGSLVFSKASEHQVPAGGALAVDRALFSEDLTRTVADHPLVEI
RREELRSLPTEGIVVLCTGPLTSPDLAEDLQRFTGQDYCSFFDAASPIVTGESIDQAIAF
RASRYDKGEAAYLNCPLNRDQYLAFREALVTAEQAELKDFEQESAKFFEGCLPIEELARR
GEDTMRYGPLKPVGLFDARLGDWRDPENRSRRPYAIVQLRQEDRAGNLWNLVGFQTNLRW
GEQKRIFQMIPGLSQAEFVRFGVMHRNTFVNAPQLLDASLQFRQRPTLLAAGQLIGTEGY
SAAVAGGWLAGTNAARLALGRSPLVLPDTLVSGSLFRFISSAEPKYFQPMPPNFGILPNL
EQPPRNKKDRYAAYRDRALQDLRDWQQTHAIGNLSPSTGLATTAIA