Protein Info for Synpcc7942_1282 in Synechococcus elongatus PCC 7942

Name: moaA
Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 327 (324 residues), 350.8 bits, see alignment E=3.5e-109 PF04055: Radical_SAM" amino acids 18 to 179 (162 residues), 97.5 bits, see alignment E=1e-31 PF06463: Mob_synth_C" amino acids 185 to 310 (126 residues), 109.6 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 100% identical to MOAA_SYNE7: GTP 3',8-cyclase (moaA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to syc:syc0271_d)

MetaCyc: 46% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q56211 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Synpcc7942_1282 molybdenum cofactor biosynthesis protein A (Synechococcus elongatus PCC 7942)
MIVLADHHDRQFRYLRLSLTDVCNFRCGYCLPKGQQLDPQRPALLTLPEIRHLIEGFVAL
GIEKVRLTGGEPTLRSDLVDIVRAVAAVPGIRRVALTSNGWNLRDRLADLQAAGLTQLNL
SLDSLDAARFQAITGSSRFEAVMAALEQAIALRLPILKVNAVLLKTLNYPQLSDFVEFVR
DRPISIRFIELMQTLDNHDYFQQEFLSGSVLTEQWLAQGWQPIKRDRTAGPAQEYCHPNY
QGKLGIIAPYSPNFCQNCNRLRVTSRGALRLCLFGTGEFDLRPWLQHPDQRSQLLEQVQQ
TLSFKTAGHQLAEANSGDTRNLATYGG