Protein Info for Synpcc7942_1273 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 TIGR00197: YjeF family N-terminal domain" amino acids 10 to 208 (199 residues), 137.6 bits, see alignment E=4.4e-44 PF03853: YjeF_N" amino acids 32 to 188 (157 residues), 117.3 bits, see alignment E=7.1e-38 TIGR00196: YjeF family C-terminal domain" amino acids 225 to 495 (271 residues), 198.8 bits, see alignment E=1.2e-62 PF01256: Carb_kinase" amino acids 251 to 493 (243 residues), 194.5 bits, see alignment E=2.1e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_1273)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NR6 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Synpcc7942_1273 hypothetical protein (Synechococcus elongatus PCC 7942)
MAALSLADRVVVTAEQMQAIESRLFAAGMPVAALMEKVAGLLSQRLQMAYPDRTQRWGIW
VGPGHNGGDALVVARELHLQGYPVQIWHPFERRKPLTEAHLQFAQHLGISIACDYPEHCD
RWLDGGFGFGLNRPLNEATQTAIAQLNDSGKPILSIDLPSGLDTDSGEPLGAAIRAERTY
CLGLWKQGLLQLVAAPWHGELERVDFGIAEADIVAVLGAVPDRQILTDEAAIAALPLPIA
ADAHKYRRGQLLLIAGSQRYRGAALLAALAARSSGVGMMTLAVPASLSAIAIAQVPEALV
VACPETETGEIAELPIDCDRYNAIAIGPGVGTGPTIRTILHRVLQQSTPFLIDADALTVL
AQHPEDWALRPAEARTVITPHAGEFQRLFGSAPTPASLSSAASERSLILVRKGPSPTVVT
PVGASWALVDSTPALARGGSGDVLTGLLGGLLAQTDAVSAAIAATWWHSRTAQAIAQKQT
ALGVTPTELAAQLTPWLGQRLQSEIAQYLAS