Protein Info for Synpcc7942_1243 in Synechococcus elongatus PCC 7942

Annotation: cyclic nucleotide-binding domain (cNMP-BD) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00027: cNMP_binding" amino acids 31 to 116 (86 residues), 54.6 bits, see alignment E=4.4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_1243)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NU6 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Synpcc7942_1243 cyclic nucleotide-binding domain (cNMP-BD) protein (Synechococcus elongatus PCC 7942)
MADSSAVQQHPLFANLSAEQLARLTQASRPRHYPAGQAVLLEHDWSDGYYLITAGIAKVA
IASSGGDEVIVGLLGAGELFGELRALGFEARTAEVTALTALQVIHLQSTPLSQALQVEPQ
LGLRLAQGLARRLLETNRRFAYRSEDATARVVEALDCLAQKAALPQTTSAWQPVPLINVS
IVGSLAGMARETASRELSTLEKRGFLVRKSDPWQLSVQLLRRYGLRAESAS