Protein Info for Synpcc7942_1230 in Synechococcus elongatus PCC 7942

Name: lgt
Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 14 to 273 (260 residues), 262.6 bits, see alignment E=2.2e-82 PF01790: LGT" amino acids 16 to 265 (250 residues), 279 bits, see alignment E=1.4e-87

Best Hits

Swiss-Prot: 100% identical to LGT_SYNE7: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 99% identity to syc:syc0320_d)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NV9 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Synpcc7942_1230 prolipoprotein diacylglyceryl transferase (Synechococcus elongatus PCC 7942)
VAIVTLLALQFTSPGPTLVEIGPLSIRWYGLLIASAVLLGISLSSRLARRRDIDPNAIAD
LAVWLVIGAIPAARLYYVAFEWQQYASRPAEILAIWHGGIAIHGAILGGTAALILFARRR
QIPIWQLTDVVVPSLALGQAIGRWGNFFNSEAFGTPTDLPWKLFIPIDRRPLAYIQSEYF
HPTFLYESLWNLLLCLLLIWLFRQGLRQRLPLKAGVMTCIYLIGYSLGRIWIEGLRTDSL
MLGSLRIAQMVSIVAIAFGVLGLVWIYGLKRSLPDVVRPAISGESRSEL