Protein Info for Synpcc7942_1103 in Synechococcus elongatus PCC 7942

Annotation: glucosamine-6-phosphate isomerase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01182: Glucosamine_iso
  • amino acids 11 to 223 (213 residues), 86.6 bits, E=1.1e-28

Best Hits

Swiss-Prot: 44% identical to GNPI2_GIAIN: Glucosamine-6-phosphate isomerase 2 (GPI2) from Giardia intestinalis

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 99% identity to syc:syc0446_d)

MetaCyc: 42% identical to glucosamine 6-phosphate isomerase 1 (Giardia intestinalis)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (3/6 steps found)
• chitin derivatives degradation (2/8 steps found)
• chitin degradation I (archaea) (1/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See Q31P86 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Synpcc7942_1103 glucosamine-6-phosphate isomerase 2 (Synechococcus elongatus PCC 7942)
MRCLVFPSPADVIQAVADRIADRLQAQPDLSLGLATGRTMVPLYAELLGRSLNWQHCRIF
ALDEYWGLATDHPSSFAAELRQRFCQPAGLRPEQVQFLNGAALDPAQESQRYRRCLEQAG
GLDLQLLGLGENGHLAFNEPGSARESRVRLVQLSDRTRQQNAGAFGGDPEAVPSAALSLG
LADILEARELLWLVTGASKTKILAQALQPPPTTAIPASYLQEHPATTLYADHAAAAALTV
DQS