Protein Info for Synpcc7942_1068 in Synechococcus elongatus PCC 7942

Name: pdhC
Annotation: branched-chain alpha-keto acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 76 (73 residues), 60.7 bits, E=1.4e-20
• PF02817: E3_binding
  • amino acids 131 to 165 (35 residues), 56.1 bits, 5.3e-19
• PF00198: 2-oxoacid_dh
  • amino acids 212 to 428 (217 residues), 198.8 bits, E=1.4e-62

Best Hits

Swiss-Prot: 56% identical to ODP24_ARATH: Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic (LTA2) from Arabidopsis thaliana

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to syf:Synpcc7942_1068)

MetaCyc: 100% identical to pyruvate dehydrogenase complex E2 component monomer (Synechococcus elongatus PCC 7942 = FACHB-805)
PYRUVDEH-RXN [EC: 1.2.1.104]

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• pyruvate fermentation to acetate II (2/3 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• pyruvate fermentation to acetate V (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.104 or 2.3.1.12

Sequence Analysis Tools

See Q31PC1 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Synpcc7942_1068 branched-chain alpha-keto acid dehydrogenase subunit E2 (Synechococcus elongatus PCC 7942)
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLASLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVFRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARATETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL