Protein Info for Synpcc7942_1053 in Synechococcus elongatus PCC 7942

Name: cpcA2
Annotation: phycocyanin, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01338: phycocyanin, alpha subunit
  • amino acids 3 to 163 (161 residues), 293.5 bits, E=2.1e-92
• PF00502: Phycobilisome
  • amino acids 9 to 162 (154 residues), 169.8 bits, E=2.2e-54

Best Hits

Swiss-Prot: 100% identical to PHCA_SYNE7: C-phycocyanin alpha chain (cpcA1) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02284, phycocyanin alpha chain (inferred from 99% identity to syc:syc0500_c)

MetaCyc: 100% identical to phycocyanin, alpha subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"Phycocyanin alpha chain" in subsystem Phycobilisome

Sequence Analysis Tools

See P13530 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Synpcc7942_1053 phycocyanin, alpha subunit (Synechococcus elongatus PCC 7942)
MSKTPLTEAVAAADSQGRFLSSTELQVAFGRFRQAASGLAAAKALANNADSLVNGAANAV
YSKFPYTTSTPGNNFASTPEGKAKCARDIGYYLRIVTYALVAGGTGPIDEYLLAGLDEIN
KTFDLAPSWYVEALKYIKANHGLSGDSRDEANSYIDYLINALS