Protein Info for Synpcc7942_1008 in Synechococcus elongatus PCC 7942

Name: purU
Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to PURU_SYNY3: Formyltetrahydrofolate deformylase (purU) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 99% identity to syc:syc0537_d)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

formaldehyde oxidation VII (THF pathway) (4/4 steps found)
folate transformations I (8/13 steps found)
purine nucleobases degradation I (anaerobic) (4/15 steps found)
purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PI1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Synpcc7942_1008 formyltetrahydrofolate deformylase (Synechococcus elongatus PCC 7942)
MKRATATLLISCPDQQGLVARISNFIFANGGNIIDADQHTDFEAGLFLSRIEWELTGFNL
DRELIGPAFEAIARPLGAQWQLHFSDRKPRLSLWVSKQDHCLLDLLWRQQAGELDAEIPL
IISNHDKLRPIAEQFGIDFLHLPITRETKAEQEARQLAAIADYGIDLVVLAKYMQVLSSE
FLAQFPQVINIHHSFLPAFAGANPYQRAYERGVKIIGATAHYVTPDLDEGPIIEQDVVRV
SHRDDADDLVRKGKDLERIVLARAVRLHLQHRVLTYRNRTVVFA