Protein Info for Synpcc7942_1006 in Synechococcus elongatus PCC 7942

Annotation: TPR repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13176: TPR_7" amino acids 76 to 104 (29 residues), 16.4 bits, see alignment (E = 6.4e-06) amino acids 113 to 139 (27 residues), 16.8 bits, see alignment (E = 4.7e-06) PF13181: TPR_8" amino acids 76 to 104 (29 residues), 17.9 bits, see alignment (E = 2.1e-06) amino acids 112 to 138 (27 residues), 19.8 bits, see alignment (E = 5.2e-07) amino acids 179 to 205 (27 residues), 13.6 bits, see alignment (E = 5.3e-05) amino acids 243 to 274 (32 residues), 14 bits, see alignment (E = 3.7e-05) PF13432: TPR_16" amino acids 78 to 136 (59 residues), 30.3 bits, see alignment E=3.8e-10 amino acids 111 to 172 (62 residues), 26.9 bits, see alignment E=4.4e-09 amino acids 180 to 242 (63 residues), 26.9 bits, see alignment E=4.2e-09 amino acids 285 to 338 (54 residues), 29.5 bits, see alignment 6.4e-10 PF14559: TPR_19" amino acids 120 to 172 (53 residues), 25.7 bits, see alignment 9.2e-09 amino acids 286 to 342 (57 residues), 28.2 bits, see alignment E=1.6e-09 PF13414: TPR_11" amino acids 181 to 219 (39 residues), 27.9 bits, see alignment 1.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0539_c)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PI3 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Synpcc7942_1006 TPR repeat (Synechococcus elongatus PCC 7942)
MLARLGARLAIGVMVLGSPAIVSVSAQPAQAAVPNPELSRLLDAGSEAVKQRRWAEALGL
YQQAQLIDGQDARIASAIGYLYTELGDFRQAALSFERAIAMDSQTAAFAFGAATAYANLG
EYAAAERYYEQSLRLDNKRAEAYRGLATVQQRRGNLVGAINTYQRWQQLEPNNWQPRNEM
GKIYLQQRQFTNALQVLQAATRLAPREADIYSNLAIAQLGLNNPRAALTSLQSSISLDPR
NPRTLLKAGDIYLVLGDREAANRNYRRAFELNRNSAKTLDRYTQILLDQGDATLATVYLR
DALRLEPRNPDFHLRLGLAYLARGLKPEARSSLNQAALLYQQRGDSNGQQQAAAALRQL