Protein Info for Synpcc7942_0973 in Synechococcus elongatus PCC 7942

Name: ugd
Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF03721: UDPG_MGDP_dh_N" amino acids 4 to 136 (133 residues), 100.1 bits, see alignment E=1.8e-32 TIGR03026: nucleotide sugar dehydrogenase" amino acids 5 to 371 (367 residues), 328.6 bits, see alignment E=2.5e-102 PF00984: UDPG_MGDP_dh" amino acids 163 to 254 (92 residues), 134.2 bits, see alignment E=2.2e-43 PF03720: UDPG_MGDP_dh_C" amino acids 278 to 375 (98 residues), 97.7 bits, see alignment E=7.4e-32

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to syf:Synpcc7942_0973)

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PL6 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Synpcc7942_0973 UDP-glucose 6-dehydrogenase (Synechococcus elongatus PCC 7942)
LAAGVAHAEVIFIAVGTPPLPNGEADMRFVEAVARGIGEHLDGETYRVIVNKSTVPIGSG
DWVRMLILDGMLARRQALVPVGAAIADSEDLPQGCFDVVSNPEFLREGTAIYDTFNPDRI
VLGGSSDRAFAKMQELYEPIVQRQFAVDRDRPPVPVLRTDLGSAEMIKYAANAFLATKIS
FINEVANICDRVGADVVQVAKGMGLDARIGSRFLNAGLGWGGSCFPKDVSALVHIAQDYG
YPAALLEATIAVNQRQRLILLEKLQQELKILKGKTIGLLGLTFKPDTDDLRDAPSLTLAE
QLLRLGAKVKAYDPIVKTAPIAGLEITTSPLDLASGCDALALVTEWQEFQELDYLPLAAR
MRRPLIIDGRNCLDRDRLQMQGFRYIGIGR