Protein Info for Synpcc7942_0958 in Synechococcus elongatus PCC 7942

Name: purN
Annotation: phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to PUR3_BACSU: Phosphoribosylglycinamide formyltransferase (purN) from Bacillus subtilis (strain 168)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 100% identity to syc:syc0584_d)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PN1 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Synpcc7942_0958 phosphoribosylglycinamide formyltransferase (Synechococcus elongatus PCC 7942)
MSSLTVPDRFPTESSTAIALGVLASGNGSNFEALAQAITADQLQAEIRLLIYNNPDAYVR
QRAERLGIPALLLDHRQFASREDLDQAIITAFRNRGVEWIAMAGWMRLVTETLIQAFPER
IINIHPSLLPSFKGIRAVEQAIAAKVRISGCTAHLVTLDVDSGPILVQAAVPVLPDDTVD
SLQQRIQVEEHKILPLAIALAAARSPLPV