Protein Info for Synpcc7942_0879 in Synechococcus elongatus PCC 7942

Name: rhnB
Annotation: RNase HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 70 to 88 (19 residues), see Phobius details PF01351: RNase_HII" amino acids 22 to 202 (181 residues), 146 bits, see alignment E=7e-47

Best Hits

Swiss-Prot: 100% identical to RNH2_SYNE7: Ribonuclease HII (rnhB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 100% identity to syf:Synpcc7942_0879)

MetaCyc: 49% identical to RNase HII (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31PW0 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Synpcc7942_0879 RNase HII (Synechococcus elongatus PCC 7942)
VSPKTRLDSDFFGPGDRWQTVAGVDEVGRGCLFGPVVTAAVILPETAIAPLQQAGVTDSK
RLSQRQRQQLYPLICEVALATGWGLASVAEIERWNILQATFLAMRRAIAKLDRPISRCLI
DGNQQVPQLTYPQTTVIQGDRHCITIAAASILAKVWRDRLIERLDERYPGYALGRHKGYG
TAQHRQAILQLGPTPLHRIRFLRSLRQPSQQIDLF