Protein Info for Synpcc7942_0830 in Synechococcus elongatus PCC 7942

Name: asnC
Annotation: asparaginyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00457: asparagine--tRNA ligase" amino acids 5 to 462 (458 residues), 662.8 bits, see alignment E=1.3e-203 PF01336: tRNA_anti-codon" amino acids 19 to 98 (80 residues), 44.1 bits, see alignment E=1.6e-15 PF00152: tRNA-synt_2" amino acids 122 to 456 (335 residues), 230.4 bits, see alignment E=2.7e-72

Best Hits

Swiss-Prot: 73% identical to SYN_NOSS1: Asparagine--tRNA ligase (asnS) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01893, asparaginyl-tRNA synthetase [EC: 6.1.1.22] (inferred from 100% identity to syf:Synpcc7942_0830)

MetaCyc: 60% identical to asparagine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Asparagine--tRNA ligase. [EC: 6.1.1.22]

Predicted SEED Role

"Asparaginyl-tRNA synthetase (EC 6.1.1.22)" in subsystem tRNA aminoacylation, Asp and Asn (EC 6.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q07 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Synpcc7942_0830 asparaginyl-tRNA synthetase (Synechococcus elongatus PCC 7942)
MASARIVDLLSQGQPGQTVVVRGWIRTARQLKEFTFVEVNDGSCLKGIQVVLGQELADYE
MLAKQLDTGAAIAVEGQLVASPAKGQRVELQAASVEIVGGADPEQYPLQKKRHSFEFLRT
IAHLRPRTNSLGAVMRVRNAAATAIHDFFQERGFLWVHTPIITASDCEGAGELFTVTNLD
LDKLGQSQQAPDFEQDFFGKRAYLTVSGQLEAEIMALAFSNVYTFGPTFRAENSNTSRHL
AEFWMVEPEMAFCDLGGDMDLAEAFLKFVFQRVSDRCSEDLEFFNQRIDSEVLNRAETIL
NNDFERVSYTDAIALLEKADRSFDYPVAWGIDLQSEHERYLAEEYFRKPLIVYDYPREIK
AFYMRLNDDQKTVAAMDVLAPGIGEIIGGSQREERLDVLKQRLAEANLPEENYWWYLDLR
RYGSVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTPQNAEF