Protein Info for Synpcc7942_0823 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 240 to 269 (30 residues), see Phobius details amino acids 279 to 290 (12 residues), see Phobius details amino acids 308 to 336 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 30 to 344 (315 residues), 196 bits, see alignment E=5.5e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc0716_c)

Predicted SEED Role

"FIG01150538: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q14 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Synpcc7942_0823 hypothetical protein (Synechococcus elongatus PCC 7942)
VMSWQRRLKYIIATLQPLLWLPAILLNAWCVLLIWDYFRGPISIFLSAALLSFILGLPVR
ALERWRVPRLLAVLIILAVIVVLLLLVTVTLLPILINQVSALANTLPRSLNDGFQQFQLL
EQHPFFSRIPLDLRAVLGTVVSRLSEQLQALTSRLLELLLGVASGALQTMLTLVISFYLL
LRGDEVWDGLYNWLPVRWRSRARSALELSFRNYLLSQMTIAFLIGSSATIVLLLLGLRFW
LLLGCGIGLLAIFPFGGSISIVSLAIVQMFSNPWLGFRILVFCWGTDQLIENLIAPRLFG
KSIGVHPVWVLMAILIGAQLGGLLGVILAVPTVGCLRILLDDYRVVPN