Protein Info for Synpcc7942_0809 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 90 to 114 (25 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 153 to 164 (12 residues), see Phobius details amino acids 176 to 207 (32 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details PF13231: PMT_2" amino acids 75 to 231 (157 residues), 83.8 bits, see alignment E=8.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0809)

Predicted SEED Role

"4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family" in subsystem Pterin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q28 at UniProt or InterPro

Protein Sequence (580 amino acids)

>Synpcc7942_0809 hypothetical protein (Synechococcus elongatus PCC 7942)
MFSSRSPRIMGPRRPAIAIALGLLLLAFLILVGLSLGSSTSLMSHDEGYYALQARWIVET
GDWVTPRWWQEPLYDRTIGVQWLIAASYKLFGFCTTAVRLPALLSGLATLWLTFAIGDRL
LPRPQALLAAGILLVTPLWFQYAQLATQDMPLLAVELLSIWALLQAVSGDRRANLWGFVA
GLGVGLGFLIKGFMIGVPLLAIAPWFFWYAPKLLRNRGLWLGLIVGWIPVGIWLWGSQQR
WGDLAIAQLFDKFFFLASEDLYSQPWTFYLWNLPLNAFPWPLFGLIGWVRLWLRPERDRD
LQRHYQWLLGVYPLLLLLILSSFRTRTPYYALQLLPWVALLAAMSLSWLATSLKPSSGFS
LSARQPTHRWTAMLSWTFGGLGLVLVLAAIALLSGQISALADPSLRPYGWVAIALGLGWL
TLPIVYSQRQQLRKASLLWCCGWLLGPWLGLATVSHWHLLSDRSPVTRYALQQPAVQALL
REAPVNFWAIDPVDGTTHQQWIQLALNSPRLGQRLQTITDRPAGDRVWVAPAQVPALPDN
WQHRASMQGWVLVEAVLAPAPQVAVPVEPGPPPETEPQTP