Protein Info for Synpcc7942_0763 in Synechococcus elongatus PCC 7942

Annotation: transcriptional regulator, XRE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details PF12844: HTH_19" amino acids 32 to 89 (58 residues), 30.5 bits, see alignment E=5.4e-11 PF13443: HTH_26" amino acids 32 to 91 (60 residues), 33.4 bits, see alignment E=8.6e-12 PF01381: HTH_3" amino acids 32 to 87 (56 residues), 38.8 bits, see alignment E=1.6e-13 PF13560: HTH_31" amino acids 33 to 85 (53 residues), 37.7 bits, see alignment E=4.1e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to syc:syc0772_d)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31Q74 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Synpcc7942_0763 transcriptional regulator, XRE family (Synechococcus elongatus PCC 7942)
LATPPKNPPSLRFPFLFLLVNTLMKNYAVPNIAALRKRTGLSQTQLANIVGVDPVTIRNW
ERGRSGLDWFVKLAKLCEALDCSPRDLVKDPDSESKKVPQTVNELFASF