Protein Info for Synpcc7942_0696 in Synechococcus elongatus PCC 7942
Name: psbT
Annotation: photosystem II reaction center protein T
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PSBT_SYNP6: Photosystem II reaction center protein T (psbT) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
KEGG orthology group: K02718, photosystem II PsbT protein (inferred from 100% identity to syc:syc0834_d)MetaCyc: 100% identical to Photosystem II reaction center protein T (Synechococcus elongatus PCC 7942 = FACHB-805)
Predicted SEED Role
"Photosystem II protein PsbT" in subsystem Photosystem II
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31QE1 at UniProt or InterPro
Protein Sequence (31 amino acids)
>Synpcc7942_0696 photosystem II reaction center protein T (Synechococcus elongatus PCC 7942) MESLVYIFVFVVALGVLFFAIAFREPPRIGK