Protein Info for Synpcc7942_0696 in Synechococcus elongatus PCC 7942

Name: psbT
Annotation: photosystem II reaction center protein T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 31 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details PF01405: PsbT" amino acids 2 to 31 (30 residues), 63.2 bits, see alignment E=6.3e-22

Best Hits

Swiss-Prot: 100% identical to PSBT_SYNP6: Photosystem II reaction center protein T (psbT) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K02718, photosystem II PsbT protein (inferred from 100% identity to syc:syc0834_d)

MetaCyc: 100% identical to Photosystem II reaction center protein T (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"Photosystem II protein PsbT" in subsystem Photosystem II

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QE1 at UniProt or InterPro

Protein Sequence (31 amino acids)

>Synpcc7942_0696 photosystem II reaction center protein T (Synechococcus elongatus PCC 7942)
MESLVYIFVFVVALGVLFFAIAFREPPRIGK