Protein Info for Synpcc7942_0680 in Synechococcus elongatus PCC 7942

Annotation: C-5 sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 159 to 188 (30 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 105 to 240 (136 residues), 95.2 bits, see alignment E=2.2e-31

Best Hits

KEGG orthology group: K05897, [EC: 1.3.3.-] (inferred from 100% identity to syf:Synpcc7942_0680)

Predicted SEED Role

"Sterol desaturase family protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QF7 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Synpcc7942_0680 C-5 sterol desaturase (Synechococcus elongatus PCC 7942)
VNLLDRSLSPDSLIFFGLILGRYLLIAGGLYWLFYGFLAERSTRRRVKHWPTWKKSIRSD
VGLSIASALVFALLASWLTSTPVLIHTRLYTDVSQYGFFYLIFSFFLVLILQDTSFYFCH
RLFHQPWLFRWVHRGHHRSQCPTPWTSFAFDLPEAVMQALLIIGIVFVFPVHVGILLAAL
VTMTLWSVFNHLGFSLFPDSGVSQWLAQWLIGPQHHLLHHQRYSFHYGLYFTFWDRLLGT
QIPASQPQTQRSVRLALLTAAKPLAVRGKER