Protein Info for Synpcc7942_0656 in Synechococcus elongatus PCC 7942

Name: psbC
Annotation: photosystem II 44 kDa subunit reaction center protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details PF00421: PSII" amino acids 19 to 457 (439 residues), 454.5 bits, see alignment E=2.5e-140 TIGR01153: photosystem II 44 kDa subunit reaction center protein" amino acids 21 to 452 (432 residues), 883.3 bits, see alignment E=3.3e-270 TIGR03041: chlorophyll a/b binding light-harvesting protein" amino acids 23 to 293 (271 residues), 337.5 bits, see alignment E=9.3e-105

Best Hits

Swiss-Prot: 100% identical to PSBC_SYNE7: Photosystem II CP43 reaction center protein (psbC) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02705, photosystem II CP43 chlorophyll apoprotein (inferred from 100% identity to syc:syc0872_c)

MetaCyc: 100% identical to Photosystem II 44 kDa reaction center protein (Synechococcus elongatus PCC 7942 = FACHB-805)
PSII-RXN [EC: 1.10.3.9]

Predicted SEED Role

"Photosystem II CP43 protein (PsbC)" in subsystem Photosystem II

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.9

Use Curated BLAST to search for 1.10.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P11004 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Synpcc7942_0656 photosystem II 44 kDa subunit reaction center protein (Synechococcus elongatus PCC 7942)
VVTLSSPSVIAGGRDIDSTGYAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEV
AHFVPEKPMYEQGIILLSHLATLGWGVGPGGEVVDTFPYFVVGVLHLISSAVLGLGGIYH
ALRGPESLEEYSTFFSQDWKDKNQMTNIIGYHLILLGLGAFLLVFKAMFFGGVYDTWAPG
GGDVRIISNPTLNPAVIFGYLLKSPFGGDGWIVSVDNLEDVIGGHIWIGLICISGGIWHI
LTKPFGWVRRAFIWNGEAYLSYSLGALSLMGFIASTMVWYNNTVYPSEFFGPTAAEASQS
QAFTFLVRDQRLGANIGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLDKLTNDIQPWQARRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRAWLATSHFV
LAFFFLVGHLWHAGRARAAAAGFEKGIDRATEPVLAMRDLD