Protein Info for Synpcc7942_0653 in Synechococcus elongatus PCC 7942

Name: cdv1
Annotation: Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00160: Pro_isomerase" amino acids 57 to 230 (174 residues), 133.7 bits, see alignment E=3.6e-43

Best Hits

KEGG orthology group: K03768, peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC: 5.2.1.8] (inferred from 100% identity to syc:syc0875_d)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QI4 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Synpcc7942_0653 Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family-like (Synechococcus elongatus PCC 7942)
MRSLIQVAAQGLLIGLVAWGLVACSGSTTSLSAANANPEDVGRLYPDIPRLEGNATVVLT
VNNQPIEIEVLGKDAPLTAGNFVDLVSKGVYDGTSFHRVVKEPQPFVVQGGDPQSKDPKV
PAQQLGTGSYQDPNTKQPRYLPLEITPEGASQPVYSRTLEQASVSRPPKLRHQRGAVAMA
RASFPDSASSQFYIALSDLGFLDGNYAVFGYVRSDMTVVDRIKQGDRIQSAKVTAGLDNL
KRP