Protein Info for Synpcc7942_0645 in Synechococcus elongatus PCC 7942

Name: hemL
Annotation: glutamate-1-semialdehyde aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 31 to 451 (421 residues), 601.7 bits, see alignment E=3.3e-185 PF00202: Aminotran_3" amino acids 61 to 371 (311 residues), 244.4 bits, see alignment E=9.2e-77

Best Hits

Swiss-Prot: 100% identical to GSA_SYNE7: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 100% identity to syf:Synpcc7942_0645)

MetaCyc: 73% identical to glutamate-1-semialdehyde aminotransferase (Arabidopsis thaliana col)
Glutamate-1-semialdehyde 2,1-aminomutase. [EC: 5.4.3.8]

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QJ2 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Synpcc7942_0645 glutamate-1-semialdehyde aminotransferase (Synechococcus elongatus PCC 7942)
MRRLSASLAGDARLVCEEIALVTSSPFKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQ
PIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALE
NVLAEMVIDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVK
AGSGVATLGLPDSPGVPKSTTANTLTAPYNDLEAVKALFAENPGEIAGVILEPIVGNSGF
IVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLP
VGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLS
DGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYL
APSQFEAGFTSLAHTEEDIDATLAAARTVMSAL