Protein Info for Synpcc7942_0613 in Synechococcus elongatus PCC 7942
Name: sixA
Annotation: phosphohistidine phosphatase, SixA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 100% identity to syc:syc0911_d)Predicted SEED Role
No annotation
KEGG Metabolic Maps
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Ether lipid metabolism
- Fructose and mannose metabolism
- Lipopolysaccharide biosynthesis
- Nicotinate and nicotinamide metabolism
- Riboflavin metabolism
- Sphingolipid metabolism
- Thiamine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.-
Use Curated BLAST to search for 3.1.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31QM4 at UniProt or InterPro
Protein Sequence (162 amino acids)
>Synpcc7942_0613 phosphohistidine phosphatase, SixA (Synechococcus elongatus PCC 7942) MELYLIRHGIAAERGTYADDDRRPLTATGERRSQRVAQRLLSLGLHFDVLQTSPLVRAHQ TAVILQQEGLASQIAIAPELAPEGSLTAWLRRLPPAISADQRWAIVGHEPDLGVWAEQLV WGSAQDKLVLKKAGLIGLQFPGDRPAIGAGSLFWLTPPRLLL