Protein Info for Synpcc7942_0612 in Synechococcus elongatus PCC 7942

Name: gltA
Annotation: methylcitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01800: 2-methylcitrate synthase/citrate synthase II
  • amino acids 10 to 379 (370 residues), 434.5 bits, E=1.4e-134
• PF00285: Citrate_synt
  • amino acids 10 to 362 (353 residues), 470.4 bits, E=1.8e-145

Best Hits

Swiss-Prot: 77% identical to CISY_SYNY3: Citrate synthase (gltA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to syc:syc0912_d)

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

• ethene biosynthesis V (engineered) (24/25 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• nitrogen remobilization from senescing leaves (6/8 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle III (animals) (7/10 steps found)
• glyoxylate cycle (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• TCA cycle VI (Helicobacter) (5/9 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (5/14 steps found)
• methylaspartate cycle (7/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.1

Sequence Analysis Tools

See Q31QM5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Synpcc7942_0612 methylcitrate synthase (Synechococcus elongatus PCC 7942)
MTAVSEFRPGLEGVPATLSSISFVDGQRGVLEYRGISIEQLAQQSSFLETAYLLIWGHLP
TQQELTEFEHEIRYHRRIKFRIRDMMKCFPDSGHPMDALQASAAALGLFYSRRALDDPEY
IRAAVVRLLAKIPTMVAAFQLIRKGNDPIQPRDELDYAANFLYMLTEREPDPVAARIFDI
CLTLHAEHTINASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLDMLEAIGSV
ENVEPYLDHCIATKTRIMGFGHRVYKVKDPRAVILQNLAEQLFDIFGHDPYYEIAVAVEK
AAAERLSHKGIYPNVDFYSGLVYRKLGIPSDLFTPVFAIARVAGWLAHWKEQLNENRIFR
PTQIYTGSHNLDYTPIADRDLAIESD