Protein Info for Synpcc7942_0612 in Synechococcus elongatus PCC 7942
Name: gltA
Annotation: methylcitrate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to CISY_SYNY3: Citrate synthase (gltA) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to syc:syc0912_d)Predicted SEED Role
"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)
MetaCyc Pathways
- ethene biosynthesis V (engineered) (24/25 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
- nitrogen remobilization from senescing leaves (6/8 steps found)
- partial TCA cycle (obligate autotrophs) (6/8 steps found)
- TCA cycle I (prokaryotic) (7/10 steps found)
- TCA cycle III (animals) (7/10 steps found)
- glyoxylate cycle (4/6 steps found)
- TCA cycle II (plants and fungi) (6/9 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (6/9 steps found)
- mixed acid fermentation (11/16 steps found)
- TCA cycle VI (Helicobacter) (5/9 steps found)
- TCA cycle VII (acetate-producers) (5/9 steps found)
- superpathway of glyoxylate bypass and TCA (7/12 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (5/14 steps found)
- methylaspartate cycle (7/19 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31QM5 at UniProt or InterPro
Protein Sequence (386 amino acids)
>Synpcc7942_0612 methylcitrate synthase (Synechococcus elongatus PCC 7942) MTAVSEFRPGLEGVPATLSSISFVDGQRGVLEYRGISIEQLAQQSSFLETAYLLIWGHLP TQQELTEFEHEIRYHRRIKFRIRDMMKCFPDSGHPMDALQASAAALGLFYSRRALDDPEY IRAAVVRLLAKIPTMVAAFQLIRKGNDPIQPRDELDYAANFLYMLTEREPDPVAARIFDI CLTLHAEHTINASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLDMLEAIGSV ENVEPYLDHCIATKTRIMGFGHRVYKVKDPRAVILQNLAEQLFDIFGHDPYYEIAVAVEK AAAERLSHKGIYPNVDFYSGLVYRKLGIPSDLFTPVFAIARVAGWLAHWKEQLNENRIFR PTQIYTGSHNLDYTPIADRDLAIESD