Protein Info for Synpcc7942_0611 in Synechococcus elongatus PCC 7942

Name: mutS
Annotation: recombination and DNA strand exchange inhibitor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 TIGR01069: MutS2 family protein" amino acids 8 to 793 (786 residues), 788.6 bits, see alignment E=3.5e-241 PF00488: MutS_V" amino acids 341 to 523 (183 residues), 105.8 bits, see alignment E=4.4e-34 PF20297: MSSS" amino acids 647 to 686 (40 residues), 41 bits, see alignment 1.8e-14 PF01713: Smr" amino acids 725 to 793 (69 residues), 60.5 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: K07456, DNA mismatch repair protein MutS2 (inferred from 100% identity to syf:Synpcc7942_0611)

Predicted SEED Role

"Recombination inhibitory protein MutS2" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QM6 at UniProt or InterPro

Protein Sequence (796 amino acids)

>Synpcc7942_0611 recombination and DNA strand exchange inhibitor protein (Synechococcus elongatus PCC 7942)
VAPLLPVEQEALELLEWPLLCQQVASFAATALARRAARSLPLASSQAESEYLLSQTAEAQ
ALELTLPQGLPFAGVFDIGEALARVERQAVLSGEELLQIASTLAAMRQLRRLIDAAEAAP
TLQAIVADLRTYPELEQQIHFCIEDSGEVADRASDALLGIRQQQRQVRSQILDRLNRLLR
NQSNLFQELVISRRSDRYVLPVKAGQKEAVPGIVHDSSSSGSTLYIEPRGVIELNNQLRQ
LQRREEVECEAVRRRLSEAIASVSGDLETLLAIATTLDLAVARARYGLHLEANRPRFTAS
SESICLRQLRHPLLLWQQRQDPDRSVVPVSFQLQPSLKVVAITGPNTGGKTVTLKSLGLA
GLMARAGLFVPAREPVDLPWFERILTDIGDEQSLQQSLSTFSGHIRRIGRILEALPVAGA
SLVLLDEVGAGTDPSEGSALAIALLRYLADHATLTIATTHYGELKALKYQDDRFENASVE
FDDRTLSPTYRLLWGIPGRSNALIIAERLGLSPAVVAEARSQLEGGRDRDVDAVIAGLEA
QRRDQEEKAAAAAQLLQQTEKLHAELQAKTAELREREQSLRQQQEVAIQSEIEQARQRVA
KVVRRLQQGPKATKAERARQASETLKSLSQPAVTVVAPPPGFQPQLGDRLRIPRLGKVGE
VLAIAPDRQELTVRCGILKLTVSYGDVESLQGEKVELPPPPPKSTTPPPPPKDAPAIRTD
RNTFDVRGSRVSEAEVVLEDALRQAIGPIWIIHGHGTGKLRQGVQQFLREHPLVAKFEAA
DQADGGNGVTIAYPKT