Protein Info for Synpcc7942_0582 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00561: Abhydrolase_1" amino acids 71 to 311 (241 residues), 35.1 bits, see alignment E=1.2e-12 PF12697: Abhydrolase_6" amino acids 88 to 309 (222 residues), 35.9 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: K07019, (no description) (inferred from 100% identity to syf:Synpcc7942_0582)

Predicted SEED Role

"Hydrolase alpha/beta fold family, slr0264 homolog" in subsystem Synechocystis experimental

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QQ5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Synpcc7942_0582 hypothetical protein (Synechococcus elongatus PCC 7942)
MPLYPDRFRCPFVLRQGWGMTIAAALASDRPPSLPAPIYQGQCLRGADDVPLWTERAIPT
NPRGTLIATYGITGSLQNQGILQRWATAAYQAGLAVLLFDWRAHGRSLELSPVLTSDGLR
EGDDFLALAGQARQLGLPEPYIFGGYSLGGQLALWGAWRGQQEGCPPAAVLSLCPNLDAE
RSLPWLRSTRLGRWIEQRICRELCRLATDIANHHPGSLDPAAIAQVTTIQDFDNYLVAPR
LGFQSSVDYYRASSPLPFLADLHVPGLVLYAADDPFFHPAIAPELAAIAQRNPVLEIEIT
RHGGHVGYWQGRDRWWAIDRFQGWLEDSGTLPKA