Protein Info for Synpcc7942_0552 in Synechococcus elongatus PCC 7942

Name: nfrC
Annotation: UDP-N-acetylglucosamine 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00236: UDP-N-acetylglucosamine 2-epimerase" amino acids 6 to 364 (359 residues), 525.5 bits, see alignment E=3.7e-162 PF02350: Epimerase_2" amino acids 27 to 363 (337 residues), 364.9 bits, see alignment E=1.9e-113

Best Hits

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 100% identity to syc:syc0969_c)

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QT5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Synpcc7942_0552 UDP-N-acetylglucosamine 2-epimerase (Synechococcus elongatus PCC 7942)
MTQAPIRVCITLGTRPEAIKLAPVIRAFQQDPTFQTQVVLTGQHREMVEQVMQLFGLQPD
RDLAIMQPRQTLTSITSRSLEGLETLFQELEPQLVLVQGDTTTAFAAALAAFYQKIPVGH
VEAGLRTDNLFNPYPEEANRRLISQIAQLHFAPTPLAVENLRASGVVGEVHLTGNTVIDA
LLTVADRQPDCPIAGLDWSRYRVLLATVHRRENWGEPLQDIAQGFLAILEAVPDAALLLP
LHRNPTVREPLQALLGQHPRVFLTEPLDYSELVGAIQRSTLLLTDSGGLQEEAPSLGKPV
LVLRETTERPEAVTAGTAKLIGTQADRIAQEALTLLQDPAAYAAMANAANPFGDGQASGR
IVQLSRQFLGSA