Protein Info for Synpcc7942_0531 in Synechococcus elongatus PCC 7942

Annotation: TPR repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF09295: ChAPs" amino acids 44 to 100 (57 residues), 21.4 bits, see alignment E=1e-07 PF23914: TPR_CcmH_CycH" amino acids 55 to 173 (119 residues), 45.4 bits, see alignment E=7.5e-15 PF13432: TPR_16" amino acids 64 to 110 (47 residues), 18.6 bits, see alignment 2e-06 amino acids 81 to 143 (63 residues), 39.1 bits, see alignment E=7.1e-13 amino acids 114 to 172 (59 residues), 32.5 bits, see alignment E=8.3e-11 amino acids 184 to 244 (61 residues), 25.1 bits, see alignment E=1.8e-08 PF13181: TPR_8" amino acids 77 to 107 (31 residues), 20 bits, see alignment 5.1e-07 amino acids 112 to 142 (31 residues), 14.1 bits, see alignment 4e-05 amino acids 146 to 176 (31 residues), 16.6 bits, see alignment 6.4e-06 amino acids 179 to 210 (32 residues), 12.4 bits, see alignment 0.00014 PF13428: TPR_14" amino acids 77 to 118 (42 residues), 24.5 bits, see alignment 2.5e-08 PF12895: ANAPC3" amino acids 90 to 170 (81 residues), 31.7 bits, see alignment E=1.4e-10 PF07719: TPR_2" amino acids 111 to 142 (32 residues), 23.9 bits, see alignment 2.8e-08 amino acids 146 to 176 (31 residues), 24 bits, see alignment 2.7e-08 amino acids 179 to 210 (32 residues), 24.3 bits, see alignment 2.1e-08 PF13176: TPR_7" amino acids 113 to 142 (30 residues), 14.6 bits, see alignment (E = 2.7e-05) PF14559: TPR_19" amino acids 121 to 181 (61 residues), 31.8 bits, see alignment E=1.3e-10 PF00515: TPR_1" amino acids 146 to 177 (32 residues), 30 bits, see alignment 2.8e-10 PF13414: TPR_11" amino acids 151 to 192 (42 residues), 34.9 bits, see alignment 8.9e-12 PF13374: TPR_10" amino acids 180 to 209 (30 residues), 17.9 bits, see alignment (E = 2.3e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0531)

Predicted SEED Role

"FIG01156760: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QV6 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Synpcc7942_0531 TPR repeat (Synechococcus elongatus PCC 7942)
VKRTALLALLAALSCSGTAFSPAQAFTPYVPDLDSKYLEEQGLVLAQEAAQLLQFQQIEF
AQRQAALATQLAPNDFRVWLVLADASLRLNQLDPAIAALEKAQKLSPREPAILFALGSAR
FRQGNYSEAASFLQRGLAIKPDSSGALFDLGNVYLIQKQYPPAIAAFQKAVQVKPDFWEA
INNLGLVSYEQGDRNQALNYWNRAIELSKDAAEPVLAKAVLVYQQGQTEEAVRLAQQALG
KDSQYVSLDFLKEQLWGDRLLADTNRLFQAPGLQATLLEARQRAQTP