Protein Info for Synpcc7942_0512 in Synechococcus elongatus PCC 7942

Name: ycf84
Annotation: conserved hypothetical protein YCF84

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF03739: LptF_LptG" amino acids 32 to 390 (359 residues), 295.4 bits, see alignment E=3e-92

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0512)

Predicted SEED Role

"FIG01153943: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31QX5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Synpcc7942_0512 conserved hypothetical protein YCF84 (Synechococcus elongatus PCC 7942)
MTTPDLSLASSSTQPKPSLRLPWWDRISIMDRYILREMLGPFLFGVGAFTSVGLSIGVVF
ELVRQVTEAGLPLSVAAQVFLLKMPDFLVLAFPMSMLLSALMAYNRLSSDSELIALRSCG
ISSYRFILPGILMSIVVTGMTFAFYESVVPAANFQAQVTLQTALNQTRPQLEEKNNIVYQ
QFDRKTSELARIFYARRYDGEQMRGLTILDFTRGELSQIISAETGVWHPGDQLWEFRNGT
IYGVAPDGSYSGIATFKSQEFTIPETPLSIASQSRDETQMNATQIWQYLRVLRQTNNTAD
IRKWEVRLQQKLALPFVCVAFGLIGASLGTAPNQRTGRATGFGISVLIIFSYYLLAFVTG
ALGINGTLPTLLAGWFPWLLGMGVGLYLLRQTAR