Protein Info for Synpcc7942_0481 in Synechococcus elongatus PCC 7942

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00089: Trypsin" amino acids 58 to 215 (158 residues), 40.9 bits, see alignment E=3.2e-14 PF13365: Trypsin_2" amino acids 66 to 198 (133 residues), 92.9 bits, see alignment E=5.1e-30 PF06282: DUF1036" amino acids 256 to 368 (113 residues), 75.8 bits, see alignment E=6.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_0481)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31R06 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Synpcc7942_0481 protease (Synechococcus elongatus PCC 7942)
MPTVSRIWQPLLGLALVSLLVQSCGRSRQALNPSGNLCGSRQLEASDIFKRSKGSVVKIE
TATGLGSGFVVKNDNGSIILTNAHVVKGNGGTLTVKDVRGNVVDAQLLAVGEGEADSSDL
ALIKTETEIGTPLKLSDDIETASTVYAIGSPLGQEWSISQGIISRFVTDQGLIQTDIAIN
PGNSGGPVLDKRGCVVGVVVSKLDPAQSEGIGFAIEPRIAERYVKENAGNQAIAIDQFSE
PEETQVEQVENPDRNEAGYEVCNQSGENLSVAIAYFDTSIDSYRSEGWWNLDQSKCQFFP
NLLDSVDEVYVFAESDQTLWSGDFPFCMQEDAFDYPDANRDRCPSPAYSKGFLKVEVGDA
KTWTTNLTPSQ